PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000222097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TALE
Protein Properties Length: 334aa    MW: 37716.5 Da    PI: 6.7869
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000222097genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.3e-092582902355
                    SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    +yps++++  LA+++gL+ +q+ +WF N+R ++
  MDP0000222097 258 PYPSEAQKLALAESTGLELKQINNWFINQRKRH 290
                    8*****************************885 PP

2ELK40.65.4e-14210231122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK qLl+KYsgyLg+LkqEF+
  MDP0000222097 210 ELKVQLLHKYSGYLGTLKQEFM 231
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.4E-1664108IPR005540KNOX1
PfamPF037906.8E-2166104IPR005540KNOX1
SMARTSM012561.7E-24119170IPR005541KNOX2
PfamPF037917.3E-21124168IPR005541KNOX2
PROSITE profilePS5121310.755210230IPR005539ELK domain
SMARTSM011887.6E-7210231IPR005539ELK domain
PfamPF037898.7E-9210231IPR005539ELK domain
PROSITE profilePS5007111.499230293IPR001356Homeobox domain
SMARTSM003893.8E-11232297IPR001356Homeobox domain
SuperFamilySSF466895.43E-19232305IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-27235295IPR009057Homeodomain-like
CDDcd000862.73E-11242294No hitNo description
PfamPF059206.3E-17250289IPR008422Homeobox KN domain
PROSITE patternPS000270268291IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEGGSSRNSS NLGFLDSSLA AALMNSETRT TSSNSYSKQF LSVPLINNIY NLQSHPQETT  60
DQEMGVKAKI IAHPLFPRLL SAYVNCQKVG APPEVVARLE QVCSAYNSEA AKRSSIRGGG  120
GDDHPDPALD QFMEAYCEML TKYEEELTKP FKEAMLFLSN IDSQLKALAY NSNSSSESAS  180
TSGGDFVGLG RSPEEANAIN DIDPQAENRE LKVQLLHKYS GYLGTLKQEF MKKKKNGKLP  240
KEARHQLFDW WCRHYKWPYP SEAQKLALAE STGLELKQIN NWFINQRKRH WKPSEDMQFV  300
LMDPTLHQHH HYPHFCMDNA ICNPFPMDCT STLL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.15611e-139cell culture
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379653.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-113HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE81e-129D3IWE8_PRUPE; Class I KNOX homeobox transcription factor STM-like 1
STRINGVIT_12s0059g01190.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-106KNOX/ELK homeobox transcription factor